" /> ceratoxin, ceratophrys calcarata - CISMeF





Preferred Label : ceratoxin, ceratophrys calcarata;

MeSH note : a 63-aa peptide with amino acid sequence, NVTPATKPTPSKPGYCRVMDELILCPDPPLSKDLCKNDSDCPGAQKCCYRTCIMQCLPPIFRE; a snake venom-like waprin from the frog of Ceratophrys calcarata contains antimicrobial function.;

Is substance : O;

Details


You can consult :


Nous contacter.
10/08/2025


[Home] [Top]

© Rouen University Hospital. Any partial or total use of this material must mention the source.