" /> hipposin protein, hippoglossus hippoglossus - CISMeF





Preferred Label : hipposin protein, hippoglossus hippoglossus;

MeSH note : a histone-derived antimicrobial peptide in Atlantic halibut (Hippoglossus hippoglossus L.); MW 5458.4 Da; amino acid sequence: SGRGKTGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAHRVGAGAPVYL. in first source;

Is substance : O;

Details


You can consult :


Nous contacter.
06/09/2025


[Home] [Top]

© Rouen University Hospital. Any partial or total use of this material must mention the source.