" /> Arginase-1 Long Peptide Vaccine - CISMeF





Preferred Label : Arginase-1 Long Peptide Vaccine;

NCIt synonyms : ArgLong2(169-206) Peptide Vaccine; ARG-1 Peptide Vaccine; ARGLong2; Arginase1 Long Peptide Vaccine;

NCIt definition : A peptide cancer vaccine comprised of a long peptide, amino acid 169 through 206 (ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL), obtained from arginase-1, with potential immunomodulating and antineoplastic activities. Upon vaccination, the arginase-1 long peptide vaccine may activate the immune system to induce a cytotoxic T-lymphocytes (CTLs)-mediated immune response against arginase-1-expressing cells. Arginase-1 is expressed by some cancer cells and by immune inhibitory cells, such as myeloid-derived suppressor cells (MDSCs) and tumor-associated macrophages (TAMs); its expression is associated with poor prognosis.;

NCI Metathesaurus CUI : CL1647568;

Details


You can consult :


Nous contacter.
20/08/2025


[Home] [Top]

© Rouen University Hospital. Any partial or total use of this material must mention the source.