NCIt definition : A peptide cancer vaccine comprised of a long peptide, amino acid 169 through 206 (ISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRL),
obtained from arginase-1, with potential immunomodulating and antineoplastic activities.
Upon vaccination, the arginase-1 long peptide vaccine may activate the immune system
to induce a cytotoxic T-lymphocytes (CTLs)-mediated immune response against arginase-1-expressing
cells. Arginase-1 is expressed by some cancer cells and by immune inhibitory cells,
such as myeloid-derived suppressor cells (MDSCs) and tumor-associated macrophages
(TAMs); its expression is associated with poor prognosis.;