" /> dual altered peptide ligand - CISMeF





Preferred Label : dual altered peptide ligand;

MeSH note : artificial peptide with two immunodominant T-cell epitopes of the nicotinic acetylcholine receptor substituted with Lys-262 and Ala-207 (VIVKLIPSTSSAVDTPYLDITYHFVAQRLPL);

MeSH synonym : dual APL;

Is substance : O;

Details


You can consult :


Nous contacter.
19/12/2025


[Home] [Top]

© Rouen University Hospital. Any partial or total use of this material must mention the source.