" /> bombinakinin M gene associated peptide, bombina maxima - CISMeF





Preferred Label : bombinakinin M gene associated peptide, bombina maxima;

MeSH note : a bioactive 28-amino acid peptide from skin secretions of the toad Bombina maxima; amino acid sequence is DMYEIKQYKTAHGRPPICAPGEQCPIWV-NH(2);

MeSH synonym : bombinakinin-GAP, B. maxima;

Is substance : O;

Details


You can consult :


Nous contacter.
25/05/2025


[Home] [Top]

© Rouen University Hospital. Any partial or total use of this material must mention the source.