lixisenatide - CISMeF

Preferred Label : lixisenatide;

MeSH note : a synthetic glucagon-like peptide 1 (GLP-1) receptor agonist; binds GLP-1 receptor; has antidiabetic effects in mice; amino acid sequence is H-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSK KKKKK-NH2 (ZP10A);

CISMeF synonym : AQVE-10010; AVE 0010; zealand pharma brand of lixisenatide; ZP10A peptide;

MeSH synonym : DES-38-proline-exendine-4 (Heloderma suspectum)-(1-39)-peptidylpenta-l-lysyl-l-lysinamide;

MeSH hyponym : ZP-10; AVE-010; AVE0010; AVE-0010;

Is substance : O;

UNII : 74O62BB01U;

Details

Origin ID

C479460;

UMLS CUI

C2973895;

ATC code(s)
- insulin glargine and lixisenatide [ATC Code]
- lixisenatide [ATC Code]
CISMeF manual mappings
- Lixisenatide (substance) [SNOMED CT concept]
Currated CISMeF NLP mapping
- Lixisenatide [NCIt concept]
MeSH indexing information
- Glucagon-Like Peptide-1 Receptor [MeSH Descriptor]
MeSH term(s) associated for indexing
- Glucagon-Like Peptide-2 Receptor [MeSH Descriptor]
- peptides [MeSH Descriptor]
Pharmacological action(s)
- hypoglycemic agents [MeSH Descriptor]
Record concept(s)
- AQVE-10010 [MeSH concept]
- AVE 0010 [MeSH concept]
- AVE 010 [MeSH concept]
- Adlyxin [MeSH concept]
- Lixisenatide [MeSH concept]
- ZP 10 [MeSH concept]
- ZP10A peptide [MeSH concept]
- lyxumia [MeSH concept]
See also inter- (CISMeF)
- Product containing lixisenatide (medicinal product) [SNOMED CT concept]
Semantic type(s)
- Amino Acid, Peptide, or Protein [UMLS semantic type]
- Pharmacologic Substance [UMLS semantic type]
UMLS correspondences (same concept)
- Lixisenatide [NCIt concept]
- Lixisenatide (substance) [SNOMED CT concept]
- Product containing lixisenatide (medicinal product) [SNOMED CT concept]
- lixisenatide [ATC Code]
Validated automatic mappings to BTNT
- lixisenatide [ATC Code]

Keyword's position in hierarchy(ies) :

Main resources

You can consult :

recommendations
documents concerning education
documents for patients