" /> Ropocamptide - CISMeF





Preferred Label : Ropocamptide;

NCIt synonyms : Antimicrobial Peptide, Human [LL-37, 37 aa]; Cathelicidin LL-37;

NCIt definition : A synthetic form of a human antimicrobial peptide (37 amino acids), belonging to the cathelicidin family, with antimicrobial, anti-inflammatory, immunostimulating and potential antineoplastic activities. Upon intratumoral injection of the ropocamptide, this peptide increases p53 expression, and induces phosphatidylserine externalization, DNA fragmentation, cell cycle arrest and caspase-independent apoptosis-inducing factor (AIF)/ endonuclease G (EndoG)-mediated apoptotic cell death in susceptible cancer cells. This suppresses tumor cell proliferation. LL-37, a protein secreted by bone marrow cells, circulating leukocytes, and various epithelial tissues, plays a crucial role in the innate host immune defense via the regulation of leukocyte chemotaxis and cytokine production; it also promotes wound healing.;

UNII : 3DD771JO2H;

CAS number : 154947-66-7;

Molecule name : LL-37;

Details


You can consult :


Nous contacter.
06/07/2025


[Home] [Top]

© Rouen University Hospital. Any partial or total use of this material must mention the source.