Preferred Label : Ropocamptide;
NCIt synonyms : Antimicrobial Peptide, Human [LL-37, 37 aa]; Cathelicidin LL-37;
NCIt definition : A synthetic form of a human antimicrobial peptide (37 amino acids), belonging to the
cathelicidin family, with antimicrobial, anti-inflammatory, immunostimulating and
potential antineoplastic activities. Upon intratumoral injection of the ropocamptide,
this peptide increases p53 expression, and induces phosphatidylserine externalization,
DNA fragmentation, cell cycle arrest and caspase-independent apoptosis-inducing factor
(AIF)/ endonuclease G (EndoG)-mediated apoptotic cell death in susceptible cancer
cells. This suppresses tumor cell proliferation. LL-37, a protein secreted by bone
marrow cells, circulating leukocytes, and various epithelial tissues, plays a crucial
role in the innate host immune defense via the regulation of leukocyte chemotaxis
and cytokine production; it also promotes wound healing.;
UNII : 3DD771JO2H;
CAS number : 154947-66-7;
Molecule name : LL-37;
Origin ID : C118292;
UMLS CUI : C5418159;
Automatic exact mappings (from CISMeF team)
- Semantic type(s)
- concept_is_in_subset
