" /> conophysin-R, conus radiatus - CISMeF





Preferred Label : conophysin-R, conus radiatus;

MeSH note : the distinctive disulfide framework and sequence indicates that it is a member of the neurophysin peptide family; MW 8810.89 Da; sequence of the peptide is HPTKPCMYCSFGQCVGPHICCGPTGCEMGTAEANMCSEEDEDPIPCQVFGSDCALNNPDNIHGHCVADGICCVDDTCTTHLGCL, in first source;

MeSH synonym : conophysin-R, C radiatus;

Is substance : O;

Details


You can consult :


Nous contacter.
06/09/2025


[Home] [Top]

© Rouen University Hospital. Any partial or total use of this material must mention the source.